PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01922g02003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 285aa    MW: 31414.6 Da    PI: 8.418
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01922g02003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.15.7e-19208242135
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                               C++Cg+ kTp+WR gp g ktLCnaCG++y++ +l
  Niben101Scf01922g02003.1 208 CQHCGADKTPQWRAGPLGLKTLCNACGVRYKSGRL 242
                               *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.136202238IPR000679Zinc finger, GATA-type
SMARTSM004016.3E-16202256IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.98E-15204266No hitNo description
Gene3DG3DSA:3.30.50.101.0E-14205240IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.05E-14207256No hitNo description
PfamPF003202.0E-16208242IPR000679Zinc finger, GATA-type
PROSITE patternPS003440208233IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MKMEALGPSA ASCFMVDVDD DLLNFSLEDE TVLLDDDEKT TNSLTKHKHP FSSSYSSSLD  60
SSNPVLSLLP SQQHPEYVEE ELEWLSNKDA FPAVEFGILA DNPSIVFDHH SPVSVLENSS  120
STCNSSGNGS ANASAYMSCC ASLKVPVNYP VRARSKRRRR RRRGSFADLP GEHCMSVNKP  180
SFKIVKQREP LLSLPMNSPK SASIGRRCQH CGADKTPQWR AGPLGLKTLC NACGVRYKSG  240
RLLPEYRPAN SPTFSPTVHS NSHRKVLEMR KQKIGVGGMM IHESC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1153162RSKRRRRRRR
2155160KRRRRR
3156162RRRRRRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009618081.10.0PREDICTED: GATA transcription factor 1-like isoform X1
RefseqXP_016444155.10.0PREDICTED: GATA transcription factor 1-like isoform X1
TrEMBLQ76DY20.0Q76DY2_TOBAC; AG-motif binding protein-2
STRINGSolyc09g091250.2.11e-127(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40762445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.14e-42GATA transcription factor 1